PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G139900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 885aa    MW: 98785.7 Da    PI: 6.317
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G139900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP121.83.1e-38131207278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           Cqv+gC+adls a++yh+rhkvCe+h++++vv+++++e+rfCqqCsrfh l+efDe+k+sCr+rLakhn rrrk q+
  Sobic.003G139900.1.p 131 CQVDGCHADLSGARDYHKRHKVCEAHTRTTVVCIKNVEHRFCQQCSRFHLLQEFDEGKKSCRSRLAKHNGRRRKVQP 207
                           **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-31123192IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.761128205IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-35129210IPR004333Transcription factor, SBP-box
PfamPF031101.4E-28131204IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.14E-5618767IPR020683Ankyrin repeat-containing domain
CDDcd002041.10E-4656765No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 885 aa     Download sequence    Send to blast
MEASFLWKES GDQASAARMT GGNKNKSLNW DLNDWRWDAN LFLATPAAAA APSECSIREL  60
SRAQGEIDFG VVVDKRRRLS PEEDGSAGCS NSAVADGDNN HVVSVQRARS SEEEEEERPR  120
KGASSSTTPS CQVDGCHADL SGARDYHKRH KVCEAHTRTT VVCIKNVEHR FCQQCSRFHL  180
LQEFDEGKKS CRSRLAKHNG RRRKVQPQAA VNGNSMNENQ SLSSALFLLL KQLSGLESGS  240
SSEQINHPNS LVNILKNLTA IASTQSYQDI LKNANSNSIP SNAANNAANG SIMHEQTIRS  300
TPIGRESLAE EPPVKRRVQD FDLNDACIEE AESRTDKIVF KLFGKEPKDF PVDLREQIQN  360
WLSHYPTDME SYIRPGCVIL TIYLRLPNWM WDELDDDPAS WIEKLISLSN DGFWRKGWLY  420
ARVQDCLTLS CNGSLMFASP WQPVIGDKHQ RLCVTPIAVA CSSSVKFSVQ GFNIVQPTTK  480
LLCVFGENYL IQEETQMLLE DSTMQQGPQC LTFSCSFPCT SGRGFIEVED YDQSSLSVPF  540
VVTDNDVCSE IRTLEHGLNL ISFDETPERI DDLMAYRSRS LHFLHEIGWL LQRSHVRATS  600
EQPQYCPDRF PVARFKWLLS FAIDHEWCAV VRKLLNTMFQ GDIDLDVPSP VEFALGENLL  660
LTAVKKCSKP LVECLLRYTT TNYAPVGSGD GAPVQFLFTP AMTGLSNITP LHIAATISDA  720
TGVLDALTDD PQQLGIKAWK NARDATGFTP EEYARQRGHV SYIQMVQDKI DRRMSRDHVL  780
VTIPTTIDAV GKHASGLKSA DQITFGVEKQ LNINETSSCR QCVQQVQQFA FQPRTNRFLS  840
NRPAMLSLVA IAAVCVCVGL LMKSPPQVAC MRPFLWDNVR WGPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-25123204384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17478KRRRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.17660.0embryo| leaf| ovary| panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008673963.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A096S7G20.0A0A096S7G2_MAIZE; Uncharacterized protein
STRINGGRMZM2G133646_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Representative plantOGRP25951432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1